dvdcdnow.comLargest CD/DVD Music Online Store. Depeche mode - greatest hits, unreleased music, live records, re...

dvdcdnow.com Profile

dvdcdnow.com

Title:Largest CD/DVD Music Online Store. Depeche mode - greatest hits, unreleased music, live records, re...

Description:WWW.DVDCDNOW.COM - rare CD and DVD releases, live records, remixes and unreleased music for fans and collectors of Depeche Mode, The Beatles, The Rolling Stones, Rammstein, Evanescence, Linkin Park, Mylene Farmer etc.

Keywords:Music, Store, rare, CD, DVD, releases, live, records, remixes, unreleased, fans, collectors,

Discover dvdcdnow.com website stats, rating, details and status online. Read and write reviews or vote to improve it ranking. Check alliedvsaxis duplicates with related css, domain relations, most used words, social networks references. Find out where is server located. Use our online tools to find owner and admin contact info. Go to regular site

dvdcdnow.com Information

Website / Domain: dvdcdnow.com
Website IP Address: 88.214.202.90
Domain DNS Server: ns0.hqhost.net,ns1.hqhost.net

dvdcdnow.com Rank

Alexa Rank: 12516080
existsite Rank: 1
Google Page Rank: 0/10 (Google Pagerank Has Been Closed)

dvdcdnow.com Traffic & Earnings

Purchase/Sale Value: $9,426
Daily Revenue: $25
Monthly Revenue: $774
Yearly Revenue: $9,426
Daily Unique Visitors: 2,376
Monthly Unique Visitors: 71,280
Yearly Unique Visitors: 867,240

dvdcdnow.com Keywords accounting

Keyword Count Percentage
Music 3 0.21%
Store 2 0.14%
rare 0 0.00%
CD 3 0.09%
DVD 3 0.13%
releases 0 0.00%
live 3 0.17%
records 1 0.10%
remixes 1 0.10%
unreleased 1 0.14%
fans 0 0.00%
collectors 0 0.00%

dvdcdnow.com WebSite Httpheader

StatusCode 200
Vary Accept-Encoding
Connection Keep-Alive
Transfer-Encoding chunked
Content-Type text/html
Server Apache/2.2.22 (Debian)
Date Fri, 23 Feb 2018 04:33:03 GMT

dvdcdnow.com Traffic Sources Chart

dvdcdnow.com Alexa Rank History Chart

dvdcdnow.com aleax

dvdcdnow.com Html To Plain Text

Largest CD/DVD Music Online Store. Depeche mode - greatest hits, unreleased music, live records, remixes etc. Choose the currency: US DollarEuroAustralian DollarBritish Pound Shopping Cart: 0 item(s) Your Shopping Cart is empty! DVD CD NOW dot com - DVD/CD Music Online Store Friday 07 April, 2017 Home PAYMENT SHIPPING RETURN POLICY F.A.Q. Contact us Checkout Login # A B C D E F G H I J K L M N O P Q R S T U V W X Y Z Search By Artist/Band: Please Select10CC2 UNLIMITED50 CENTA-HAABBAAC/DCACCEPTACE OF BASEADAMOADELEADRIAN BELEWADRIANO CELENTANOAEROSMITHAFFINITYAFRIC SIMONEAIRAL BANO & ROMINA POWERAL DI MEOLAALAN PARSONSALAN PRICEALBERT COLLINSALBERT KINGALEXIS KORNERALICE COOPERALICIA KEYSALIZEEALLMAN BROTHERS BANDALPHATAURUSALPHAVILLEALVIN LEEAMANDA LEARAMERICAAMETHYSTIUMAMY WINEHOUSEANASTASIAANDREA BOCELLIANDREW LLOYD WEBBERANDY FRASER BANDANDY GIBBANGEANNA NETREBKOANNIE LENNOXANTRAXAPHRODITE'S CHILDAPOCALYPTICAAQUAAQUAARMIKARMIN VAN BUURENARMY OF LOVERSARTHUR LEEASGAERDASHKANASIAASTOR PIAZZOLLAATBATOMIC ROOSTERAVIATORAVRIL LAVIGNEAXEL RUDI PELLBACCARABACHMAN-TURNER OVERDRIVE (BTO)BACKSTREET BOYSBAD BOYS BLUEBAD COMPANYBADFINGERBARCLAY JAMES HARVESTBARRY WHITEBAY CITY ROLLERSBE-POP DELUXEBEE GEESBEGGARS OPERABELLE EPOQUEBEN HARPERBEYONCEBILL EVANSBILL WYMANBILLY IDOLBILLY JOELBIRTH CONTROLBJORKBLACK CROWESBLACK EYED PEASBLACK SABBATHBLACK WIDOWBLACKFOOTBLACKFOOT SUEBLACKMORE'S NIGHTBLIND FAITHBLIND GUARDIANBLINDSIDE BLUES BANDBLODWYN PIGBLONDIEBLOOD, SWEAT & TEARSBLOODHOUND GANGBLOODROCKBLUE SYSTEMBLURBOB DYLANBOB MARLEYBON JOVIBONEY MBONFIREBOSTONBOX OF FROGSBRAINSTORMBRIAN DAVISONBRIAN SETZERBRIAN SETZER ORCHESTRABRITNEY SPEARSBRUCE DICKINSONBRUCE SPRINGSTEENBRUFORDBRYAN ADAMSBRYAN ADAMSBRYAN FERRYBUDDY MILESBUDGIEBURZUMC.C.CATCHCACTUSCAMELCANCAPTAIN BEEFHEARTCAPTAIN JACKCARAVANCARMENCELINE DIONCERRONECESARIA EVORACHANNEL LIGHT VESSELCHERCHICAGOCHICK COREA & JOHN MCLAUGHLINCHICKEN SHACKCHICKENFOOTCHILDREN OF BODOMCHILLYCHRIS DE BURGHCHRIS ISAAKCHRIS NORMANCHRIS REACHRIS SPHEERISCHRIS THOMAS KINGCHRISTINA AGUILERACHROMA KEYCINDERELLACINEMA BIZARRECIRCUSCLANNADCLARENCE "GATEMOUTH" BROWNCLAWFINGERCLIENTCLIFF RICHARDCOCTEAU TWINSCOLDPLAYCOLIN BLUN STONECOLOSSEUMCRAIG DAVIDCREAMCREEDENCE CLEARWATER REVIVALCROSBY, STILLS, NASH & YONGCULTURE BEATCULTURE CLUBCYPRESS HILLDADADAEMONDAEVID ALLENDAEVID ALLEN & KRAMERDAFT PUNKDALIDADAMO SUZUKI BANDDARREN HAYESDARRYL WAY's WOLFDAS ICHDAVE BRUBECKDAVID BOWIEDAVID COVERDALEDAVID CROSS BANDDAVID GILMOURDAVID GUETTADAVID SYLVIANDE PHAZZDE-PHAZZDE/VISIONDEAD CAN DANCEDEAD OR ALIVEDEAN MARTINDEATHDEE D. JACKSONDEEP FORESTDEEP PURPLEDEF LEPPARDDEFTONESDEICIDEDEMIS ROUSSOSDENNIS DEYOUNGDEPECHE MODEDEREK SHERINIANDERRINGER BOGERTDESMOND CHILD AND ROUGEDESTINY'S CHILDDIAS DE BLUESDICK DALE'SDIDODIODIRE STRAITSDJ FRESHDJ TIESTODMXDMXDOKKENDONNA SUMMERDOUBLE TROUBLEDR. ALBANDr. DEMENTOSDR. HOOKDr.ZDREAM THEATERDRUIDDSCHINGHIS KHANDUANE EDDYDURAN DURANDUSTDUSTER BENNETDZYANE-TYPEEAGLESEARTH, WIND & FIREEAST OF EDENEDDIE JOBSONEDITH PIAFEINSTURZENDE NEUBAUTENELECTRIC LIGHT ORCHESTRA (E.L...ELECTRIC SUNELEGANT MACHINERYELLA FITZGERALDELOYELTON JOHNELVIS PRESLEYEMERSON, LAKE & PALMEREMINEMEMMA BUNTONENGLANDENIGMAENNIO MORRICONEENRIQUE IGLEASIASENYAERAERASUREERIC BURDONERIC CLAPTONEROS RAMAZZOTTIERYKAH BADUEUROPEEURYTHMICSEVANESCENCEEXTREMEF.R.DAVIDFAITHLESSFALL OUT BOYFAMILYFANCYFAR CORPORATIONFATBOY SLIMFAUSTO PAPETTIFEAR FACTORYFISHFLASHFLEETWOOD MACFOCUSFOO FIGHTERSFOREIGNERFRANCIS GOYAFRANK SINATRAFRANK ZAPPAFRANZ FERDINANDFREDDIE MERCURYFREEFREESTYLERSFUN LOVIN CRIMINALSG3GAMMA RAYGANYMEDGARBAGEGARY BROOKERGARY MOOREGENESISGENTLE GIANTGEORGE HARRISONGEORGE MICHAELGILESGILLAGINGER BAKER'S AIR FORCEGIORGIO MORODERGIPSY KINGSGLENN HUGHESGLENN MILLERGODSMACKGOOD WHISKEY BLUESGORILLAZGOTAN PROJECTGOTTHARDGOV'T MULEGOVIGRAHAM BONNETGRAND FUNK RAILROADGRAPEFRUITGRAVY TRAINGRAVY TRAINGREEN BULLFROGGREEN DAYGREG LAKEGREGG BISSONETTEGREGORIANGTRGUANO APESGUESS WHOGUNS'N'ROSESGUY DAVISGWEN STEFANIGYPSYHADDAWAYHAMMERFALLHAROLD BUDDHELLOWEENHERHERMAN'S HERMITSHIMHOLLIESHOUND DOG TAYLORHUBERT SUMLINHUMBLE PIEHYBRID THEORYIAN ANDERSONIAN GILLANICE CUBEIGGY POPIL DIVOILLUSIONIMPELLITTERIIN EXTREMOINCUBUSINXSIRON MAIDENJ.J.CALEJACK BRUCEJADEJAMES BROWNJAMES LASTJAMIROQUAIJEAN MICHEL JARREJEFF BECKJEFF LYNNEJEFFERSON AIRPLANEJENNIFER LOPEZJENNIFER RUSHJERRY LEE LEWISJESSE COOKJETHRO TULLJILL JONESJIM CAPALDIJIMI HENDRIXJIMMY DAWKINSJIMMY PAGEJIMMY SOMERVILLEJOE BEARDJOE BONAMASSAJOE COCKERJOE DASSINJOE LYNN TURNERJOE SATRIANIJOHN CAMPBELLJOHN COLTRANEJOHN DUMMER BLUES BANDJOHN FOGERTYJOHN LEE HOOKERJOHN LENNONJOHN MAYALLJOHN MILESJOHN NORUMJOHN WETTONJOHNNY CASHJOHNNY DRUMMERJOHNNY WINTERJON BUTCHERJOSEFUSJOYJOY DIVISIONJUDAS PRIESTJUICY LUCYJULIAN JAY SAVARINJULIO IGLESIASJUNGLE BROTHERSJUNIOR WELLSJUSTIN TIMBERLAKEKARUNESHKATE BUSHKATE RYANKATY PERRYKEANEKEEF HARTLEY BANDKEIKO MATSUIKEN HENSLEYKENNY BURRELLKENNY GKILLERSKING CRIMSONKINGDOM COMEKISSKLAUS SCHULZEKMFDMKORNKOSSOFF KIRKEKRAFTWERKKYLIE MINOGUELA BLONDALACRIMOSALADY GAGALAIBACHLARA FABIANLED ZEPPELINLENNY KRAVITZLEONARD COHENLESLIE WESTLEVEL 42LIMP BIZKITLINKIN PARKLIVIN' BLUESLIZA MINELLILOREENA McKENNITTLOUIS ARMSTRONGLOUIS PRIMALOVIN SPOONFULLUCIANO PAVAROTTILUCIFER WASLUCIFER'S FRIENDLYNYRD SKYNYRDMACHIAVELMACY GREYMADNESSMADONNAMAGNUMMAN FRED MANN'S EARTH BANDMANHATTAN TRANSFERMANOWARMANU CHAOMARC ALMONDMARIAH CAREYMARILYN MANSONMARK ALMONDMARK BOLANMARK KNOPFLERMARSUPILAMIMARY J BLIGEMASSIVE ATTACKMATCHBOX TWENTYMATCHING MOLEMATT O'REEMAX RAABEMAY BLITZMEGADETHMELVIN TAYLORMESHMETALLICAMICHAEL BROOKMICHAEL CHAPMANMICHAEL JACKSONMICK JAGGERMICK TAYLORMIKE BATTMIKE OLDFIELDMILES DAVISMIREILLE MATHIEUMOBYMODERN TALKINGMONUMENTMOONSPELLMORCHEEBAMOTORHEADMOTT THE HOOPLEMOUNTAINMOUSE ON MARSMUDDY WATERSMUNGO JERRYMUSEMY CHEMICAL ROMANCEMYLENE FARMERMYTHOSNATALIE IMBRUGLIANAZARETHNEAL BLACKNEIL DIAMONDNEIL YOUNGNELLY FURTADONEOTON FAMILIANEW TROLLSNICK CAVENICK DRAKENICKELBACKNIGHTWISHNIK KERSHAWNINA SIMONENINE INCH NAILSNIRVANANORAH JONESO.M.D.OASISOFRA HAZAOLIVER SHANTIOSCAR BENTONOSCAR PETERSONOSMONDSOTIS RUSHOTIS SPANNOTTAWANOVERKILLOZZY OSBOURNEPANTERAPAPA ROACHPATRICIA KAASPATRICK MORAZPAUL ANKAPAUL KOSSOFFPAUL MAURIATPAUL McCARTNEYPAUL SIMONPAUL VAN DYKPAULA ABDULPAVLOV's DOG familyPEARL JAMPENDULUMPET SHOP BOYSPETER BANKSPETER GABRIELPETER GREENPETER HAMMILLPHIL COLLINSPINKPINK FLOYDPJ HARVEYPLACEBOPLANET FUNKPORCUPINE TREEPROCOL HARUMPUSSYCAT DOLLSQUEENQUEENSRYCHER. KELLYR.E.M.RADIOHEADRADIOHEADRAGE AGAINST THE MACHINERAINBOWRAMMSTEINRANDY BACHMANRAY CHARLESRAY THOMASREAMONNRECOILRED HOT CHILI PEPPERSREDBONERENAISSANCERICCHI E POVERIRICHIE BLACKMORERICK WAKEMANRICKY KINGRIHANNARINGO STARRROB HALFORDROB ZOMBIEROBBIE WILLIAMSROBERT FRIPPROBERT PLANTROBIN GIBBROCKETSROD STEWARTROGER HODGSONROGER WATERSROXETTEROY ORBISONRUSHSABRINASADESAMANTHA FOXSAMMY HAGARSANDRASANTANASARAH BRIGHTMANSARAH VAUGHANSAVAGESCHILLERSCOOTERSCORPIONSSCREAMIN' JAY HAWKINSSEALSECRET SERVICESERJ TANKIANSEX PISTOLSSHAK...

dvdcdnow.com Similar Website

Domain WebSite Title
ultramusicstore.com Largest CD/DVD Music Online Store. Depeche mode - greatest hits, unreleased music, live records, re...
bear-family.com Bear Family Records- Vinyl, CD, DVD- Music Mailorder Online
sensay.com SENSAY MUSIC CD & DVD STORE
crystalballrecords.com Crystal Ball Records. Classic Hits, Oldies Music, Rare Records, CD, DVD, Doo Wop, 1950's, 1960's, ...
toolboxrecords.com Toolbox records - online vinyl record store, cd and mp3 of independant music
cdireland.com CD Ireland: Online Music Store
targetshop.dk Targetshop - online music sale (cd/lp/dvd)
ethaicd.com eThaiCD.com : Online Thai music - Entertainment Store [ Thai CD - DVD - VCD - Magazines ]
mountainmusicsite.com Mountain Music - Greatest Music Store
blakamixshop.co.uk Buy Roots, reggae & Dub Music - Vinyl, Cd & Dvd Store - blakamixshop.co.uk
hamiltonloomis.com Hamilton Loomis - Live Performance, Cd Store, Live Music
cduniverse.com CD Universe - Your Online Music and Movie Store
somethingontheradio.com Something On The Radio | The home of The Greatest Hits Of Music
studio52.gr :: Studio 52 on-line music store :: Your music world - Over 40.000 CD titles, DVD, Greek Music, Tra...
wilbertsmusic.com THE GREATEST LIVE MUSIC VENUE IN CLEVELAND
dararecords.com Dara Records - Online Irish Music and Celtic Music Store
aent.com Wholesaler, Distributor, Vinyl LP Records, CD, DVD, Blu-ray, Music, Movies, Video Games, Toys, Col...
russlovo.com Russian books, cd dvd, video, audio, music - Largest Russian BookStore in USA "Russkoe Slovo"